DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and SEC14L1

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001034662.3 Gene:SEC14L1 / 6397 HGNCID:10698 Length:719 Species:Homo sapiens


Alignment Length:299 Identity:55/299 - (18%)
Similarity:113/299 - (37%) Gaps:69/299 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSG---SSPNSIRPL----PPGLQKVAIEE-LNEVPSRVESDIAALKEWLQKQPHLCACLEDQFL 57
            :||   |||::..|:    ...|....|:. |.::....||.:..|::||| :.|.....:|:.:
Human   217 LSGDALSSPSAPEPVVGTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWLQ-ETHKGKIPKDEHI 280

  Fly    58 LSFLRGSKFSLEKAKQ------------KIDRFYSLQAVIPEVFNDQRLVDNAQVLEIIRLGVIL 110
            |.|||...|:::||::            ::|  |.|:...|           .|||:....|...
Human   281 LRFLRARDFNIDKAREIMCQSLTWRKQHQVD--YILETWTP-----------PQVLQDYYAGGWH 332

  Fly   111 RIPLDEEDTGPAVTIIRAGSYDINKFKFQDIIRVGSMFGEIMMLE-------------DDNASV- 161
            .    .:..|..:.::|.|..|.     :.::|.   .||..:|.             ::|..| 
Human   333 H----HDKDGRPLYVLRLGQMDT-----KGLVRA---LGEEALLRYVLSINEEGLRRCEENTKVF 385

  Fly   162 ----SGYLEIMDMSGVTGANLFALQPQLLSKFSAYADEAMPTRQKGIHFINVPKAFETGFKSLLG 222
                |.:..::|:.|:...:|:....:.|.:.....:...|.....:..:..|:.|...:..:..
Human   386 GRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSP 450

  Fly   223 WFPGKIKER--VSVSSD---PEAIFERVPKHYLPEEYGG 256
            :.....:.:  :...:|   |..:.:.:.|..:|:...|
Human   451 FIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSG 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 15/56 (27%)
SEC14 101..256 CDD:238099 24/177 (14%)
SEC14L1NP_001034662.3 PRELI 17..173 CDD:368069
CRAL_TRIO_N 256..301 CDD:215024 15/45 (33%)
CRAL_TRIO 326..490 CDD:366224 24/176 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.