DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and RLBP1

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_016877949.1 Gene:RLBP1 / 6017 HGNCID:10024 Length:326 Species:Homo sapiens


Alignment Length:270 Identity:66/270 - (24%)
Similarity:121/270 - (44%) Gaps:26/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQKVAIEELNEVPSRVESDIAALKEWLQKQ----PHLCACLEDQ-------FLLSFLRGSKFSLE 69
            ||| |.:||||.....|..:..|:|.:|.|    ..|...:.::       |.|.|:|..||::.
Human    54 LQK-AKDELNEREETREEAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNVG 117

  Fly    70 KAKQKIDRFYSLQAVIPEVFNDQRLVDNAQVLEIIRLGVILRIP--LDEEDT-GPAVTIIRAGSY 131
            :|.:.:..:.:.:...||:|       ::...|.:|..:....|  |...|. |..|.:....::
Human   118 RAYELLRGYVNFRLQYPELF-------DSLSPEAVRCTIEAGYPGVLSSRDKYGRVVMLFNIENW 175

  Fly   132 DINKFKFQDIIRVGSMFGEIMMLEDDNASVSGYLEIMDMSGVTGANLFALQPQLLSKFSAYADEA 196
            ...:..|.:|::......| .:||::...::|:..|.:..|.|.....:|:...|.|......::
Human   176 QSQEITFDEILQAYCFILE-KLLENEETQINGFCIIENFKGFTMQQAASLRTSDLRKMVDMLQDS 239

  Fly   197 MPTRQKGIHFINVPKAFETGFKSLLGWFPGKIKERVSVSSDP-EAIFERVPKHYLPEEYGGS--K 258
            .|.|.|.||||:.|..|.|.:..:..:...|:.|||.|..|. ...::.:.::.||.::||:  |
Human   240 FPARFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSDFGGTLPK 304

  Fly   259 GTMKDITDQM 268
            ...|.:.:|:
Human   305 YDGKAVAEQL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 13/55 (24%)
SEC14 101..256 CDD:238099 37/158 (23%)
RLBP1XP_016877949.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145917
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.