DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and CG2663

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster


Alignment Length:321 Identity:103/321 - (32%)
Similarity:171/321 - (53%) Gaps:28/321 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IRPLPPGLQKVAI-EELNEV--PSRVESDIAALKEWLQKQPHLCACLEDQFLLSFLRGSKFSLEK 70
            :.|.|.  |:|:| |||.|.  |:.:|.||..::|||:.||||...::|..|.:||||.||||||
  Fly     4 LHPTPD--QRVSIREELREPEDPADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKFSLEK 66

  Fly    71 AKQKIDRFYSLQAVIPEVFNDQRLVDNAQVLEIIRLGVILRIPLDE---------EDTGPAVTII 126
            .|:|:|.:|:::..:||.|:::.:  |.:.|.|:         ||.         ...|..:|.|
  Fly    67 VKKKLDMYYTMRNAVPEFFSNRDI--NREELNIV---------LDYVHCPTLPGITPNGRRITFI 120

  Fly   127 RAGSYDINKFKFQDIIRVGSMFGEIMMLEDDNASVSGYLEIMDMSGVTGANLFALQPQLLSKFSA 191
            |....|.......|.::|..|.|::.:.| ::..::|.:.|:|.|..:.|:.....|.::.||..
  Fly   121 RGIDCDFQPHHILDAMKVALMIGDVRLAE-ESVGIAGDIFILDASVASAAHFAKFSPTVVKKFLI 184

  Fly   192 YADEAMPTRQKGIHFINVPKAFETGFKSLLGWFPGKIKERVSVSSDPEAIFERVPKHYLPEEYGG 256
            ...||.|.:.|.:|.||:....:|.|..:..:...||:.|::..:|.|::::.||:..||.||||
  Fly   185 AVQEAYPVKVKEVHVINISPLVDTIFNFVKPFVKEKIRSRITFHNDVESLYKVVPRDLLPNEYGG 249

  Fly   257 SKGTMKDITDQMEAKLCSYRSYFEDCQHFGAHDKLREEASVLNPDESHFGVDGSFRQLVID 317
            ..|.:.::....:.||.....:|:|.:...|::.||..|...:.|  .||::|:||||.||
  Fly   250 KAGGVVELNQWWKQKLVDNTQWFKDQEDKKANESLRPGAPKTSDD--LFGMEGTFRQLNID 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 24/44 (55%)
SEC14 101..256 CDD:238099 42/163 (26%)
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 25/45 (56%)
SEC14 95..250 CDD:238099 43/164 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
44.020

Return to query results.
Submit another query.