DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and CG33966

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster


Alignment Length:311 Identity:135/311 - (43%)
Similarity:200/311 - (64%) Gaps:4/311 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SIRPLPPGLQKVAIEELNEVPSRVESDIAALKEWLQKQPHLCACLEDQFLLSFLRGSKFSLEKAK 72
            :||||.|.|||.|||.|||||::::.|||||::|:::||||.|..:||||::||||.|||||:.|
  Fly     3 AIRPLSPELQKTAIENLNEVPNKLDDDIAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSLERTK 67

  Fly    73 QKIDRFYSLQAVIPEVFNDQRLVDNAQVLEIIRLGVILRIPLDEEDTGPAVTIIRAGSYDINKFK 137
            .||||||:|:...||.:.... ||..:.|||.|||.|:.:|....|.||.:.::|...||.:|:.
  Fly    68 SKIDRFYTLRTKYPEFYLGHN-VDVDKALEIFRLGTIVILPRPLNDNGPRLALLRMACYDPSKYT 131

  Fly   138 FQDIIRVGSMFGEIMMLEDDNASVSGYLEIMDMSGVTGANLFALQPQLLSKFSAYADEAMPTRQK 202
            .|::.|...:..:||:.|||.|.|:|.:.|:|:|.||..:...:.|....|.:.:.:||:|.|.:
  Fly   132 LQEVNRAAGLMQQIMLDEDDVAIVNGLISILDLSNVTTGHFLQMSPSFAKKMTVFQEEALPLRPQ 196

  Fly   203 GIHFINVPKAFETGFKSLLGWFPGKIKERVSV-SSDPEAIFERVPKHYLPEEYGGSKGTMKDITD 266
            ||||||.|..|:|.|..:......|.:.|:.| .|..||::.::||.|||.||||..|::.::..
  Fly   197 GIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKWEALYNQIPKQYLPVEYGGENGSIPELLQ 261

  Fly   267 QMEAKLCSYRSYFEDCQHFGAHDKLREEASVLNPDESHFGVDGSFRQLVID 317
            |.|.::.:||:|:|:.:::|..:.||....|  ..||.||:.||||||.:|
  Fly   262 QWEQRILAYRNYWEEEKNYGTDESLRVGQPV--DFESLFGLQGSFRQLNVD 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 27/44 (61%)
SEC14 101..256 CDD:238099 59/155 (38%)
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 26/41 (63%)
SEC14 96..252 CDD:238099 59/155 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464504
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 1 1.000 - - FOG0006716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
76.850

Return to query results.
Submit another query.