DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and CG32407

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster


Alignment Length:300 Identity:53/300 - (17%)
Similarity:101/300 - (33%) Gaps:107/300 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PNSIRPLPPGLQKVAIEEL--------------NEVPSRVESDIAALKEWLQKQPHLCACLEDQF 56
            |:...|.|..:.:|....|              |::....:||:     |:.|            
  Fly     2 PSDQDPTPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDL-----WITK------------ 49

  Fly    57 LLSFLRGSKFSLEKAKQKI------DRFYSLQAVIPEVFNDQRLVDNAQVLEIIRLGVILRIPLD 115
               .|:...|.:||...::      .:.:.:..:.....|.:.|.|.:           :.:...
  Fly    50 ---LLQVYDFDVEKCITRLWDNLAWRKSFGVYDITEANLNQEFLNDGS-----------IYVHNK 100

  Fly   116 EEDTGPAVTI-IRAGSYDINKFKFQDIIRVGSMFGEIMMLEDDNASVSGYLEIMDMSGVTGANLF 179
            :.|..|.:.: |:..|...|:   :|::|:...:.|.:..:.:...::.:   |||:|...:|| 
  Fly   101 DRDGKPLLILTIKKHSKSRNQ---EDLLRILVFWIERLQRDSNLDKITIF---MDMTGAGLSNL- 158

  Fly   180 ALQPQLLSKFSAYADEAMPTRQKGIHFINVPKAFETGF-KSLLGWFPGK---IKERVSVSSDP-- 238
                                              :.|| ||::|.|..|   :...:.|...|  
  Fly   159 ----------------------------------DMGFIKSIIGVFETKYPYVPNYILVHDLPFL 189

  Fly   239 -EAIFERVPKHYLPEEYGGSK----GTMKDITDQMEAKLC 273
             :|.|:.| |.:||.|  ..|    .|.|||...::...|
  Fly   190 LDAAFKLV-KTFLPPE--ALKILKVTTKKDIDQYVDKDNC 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 8/50 (16%)
SEC14 101..256 CDD:238099 30/162 (19%)
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 36/189 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.