DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and CG32485

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster


Alignment Length:126 Identity:24/126 - (19%)
Similarity:46/126 - (36%) Gaps:47/126 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FLRGSKFSLEKAKQKIDRF--YSLQAVIPEVFN--------------------DQRLVDNAQVLE 102
            ::.....|.|:...::.||  |:|:....:.|.                    |.:||.|  ::.
  Fly    97 YIPAKNHSSERDIDELTRFIVYNLEEACKKCFEEVTDRLCIVFDLAEFSTSCMDYQLVQN--LIW 159

  Fly   103 II------RLGVIL---------------RIPLDEEDTGPAVTIIRAGSYDINKFKFQDII 142
            ::      ||||.|               |:.|| ::|...|..: |...::.::...||:
  Fly   160 LLGKHFPERLGVCLIINSPGLFSTIWPAIRVLLD-DNTAKKVKFV-ADEAELCQYLIPDIL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 2/16 (13%)
SEC14 101..256 CDD:238099 13/63 (21%)
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 24/126 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447125
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.