DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and Sec14l3

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001025108.1 Gene:Sec14l3 / 380683 MGIID:3617848 Length:401 Species:Mus musculus


Alignment Length:273 Identity:53/273 - (19%)
Similarity:98/273 - (35%) Gaps:68/273 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PSRVESDIAALKEWLQKQPHLCACLEDQFLLSFLRGSKFSLEKAKQKIDRFYSLQAVI------- 85
            |.:.|: :|..:|.:|.........:|.|||.:||...|.|:|::..:.::...:..:       
Mouse    10 PKQAET-LAKFRENVQDVLPALPNPDDYFLLRWLRARNFDLQKSEAMLRKYMEFRKTMDIDHILD 73

  Fly    86 ---PEVFNDQRLV---------DNAQV-LEIIRLGVILRIPLDEEDTGPAVTIIRAGSYDINKFK 137
               |||.  |:.:         |...| .:||.       |||     |...:......|:.|.|
Mouse    74 WQPPEVI--QKYMPGGLCGYDRDGCPVWYDIIG-------PLD-----PKGLLFSVTKQDLLKTK 124

  Fly   138 FQDIIRV-----------GSMFGEIMMLEDDNASVSGYLEIMDMSGVTGANLFALQPQLLSKFSA 191
            .:|..|:           |.....|:|             |.|..|:...:.:....::..:|..
Mouse   125 MRDCERILHECDLQTERLGRKIETIVM-------------IFDCEGLGLKHFWKPLVEVYQEFFG 176

  Fly   192 YADEAMPTRQKGIHFINVPKAFETGFKSLLGWFPGKIKERVSV---SSDPEAIFERVPKHYLPEE 253
            ..:|..|...|.:..:...|.|..|:..:..:.....:.::.|   :|..|.:.:.:....||..
Mouse   177 LLEENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIVVLGSNSWKEGLLKLISPEELPAH 241

  Fly   254 YGGSKGTMKDITD 266
            :||:      :||
Mouse   242 FGGT------LTD 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 13/44 (30%)
SEC14 101..256 CDD:238099 29/168 (17%)
Sec14l3NP_001025108.1 CRAL_TRIO_N 13..59 CDD:215024 13/46 (28%)
SEC14 76..246 CDD:214706 37/202 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.