DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and Clvs2

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001101929.1 Gene:Clvs2 / 361459 RGDID:1306801 Length:236 Species:Rattus norvegicus


Alignment Length:186 Identity:49/186 - (26%)
Similarity:83/186 - (44%) Gaps:27/186 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PPGLQKVAIEELNEVPSRVESDIAALKEWLQKQPHL-CACLEDQFLLSFLRGSKFS--------- 67
            |..|:|..: ||||.|..:..||..:::.:..:|.: ....:|.|:|.|||..||.         
  Rat    10 PETLEKARL-ELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLLA 73

  Fly    68 --LEKAKQKIDRFYSLQAVIPEVFNDQRLVDNAQVLEIIRLGVILRIPLDEEDTGPAVTIIRAGS 130
              .|..:|.:|.|.|.:|..|.:  .|.|.|...       |.:..:    :..|..:.::.|.:
  Rat    74 QYFEYRQQNLDMFKSFKATDPGI--KQALKDGFP-------GGLANL----DHYGRKILVLFAAN 125

  Fly   131 YDINKFKFQDIIRVGSMFGEIMMLEDDNASVSGYLEIMDMSGVTGANLFALQPQLL 186
            :|.:::...||:|...:..| .|:||....|:|::.|:|.|..|......|.|.:|
  Rat   126 WDQSRYTLVDILRAILLSLE-AMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSML 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 13/56 (23%)
SEC14 101..256 CDD:238099 20/86 (23%)
Clvs2NP_001101929.1 CRAL_TRIO_N 29..75 CDD:215024 11/45 (24%)
SEC14 103..>204 CDD:301714 20/90 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.