DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and Sec14l1

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001101779.1 Gene:Sec14l1 / 360668 RGDID:1563123 Length:720 Species:Rattus norvegicus


Alignment Length:310 Identity:55/310 - (17%)
Similarity:114/310 - (36%) Gaps:72/310 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSG---SSPNSIRPLPPGLQKVAIEE------LNEVPSRVESDIAALKEWLQKQPHLCACLEDQF 56
            :||   |||.::.....|.....::.      |.::....||.:..|::||| :.|.....:|:.
  Rat   217 LSGEVLSSPGTVAEPVVGTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWLQ-ETHKGKIPKDEH 280

  Fly    57 LLSFLRGSKFSLEKAKQ------------KIDRFYSLQAVIPEVFNDQRLVDNAQVLEIIRLGVI 109
            :|.|||...|:::||::            ::|  |.|....|           .|||:....|..
  Rat   281 ILRFLRARDFNIDKAREIMCQSLTWRKQHQVD--YILDTWTP-----------PQVLQDYYAGGW 332

  Fly   110 LRIPLDEEDTGPAVTIIRAGSYDINKFKFQDIIRVGSMFGEIMMLE-------------DDNASV 161
            ..    .:..|..:.::|.|..|.     :.::|.   .||..:|.             ::|..|
  Rat   333 HH----HDKDGRPLYVLRLGQMDT-----KGLVRA---LGEEALLRYVLSINEEGLRRCEENTKV 385

  Fly   162 -----SGYLEIMDMSGVTGANLFALQPQLLSKFSAYADEAMPTRQKGIHFINVPKAFETGFKSLL 221
                 |.:..::|:.|:...:|:....:.|.:.....:...|.....:..:..|:.|...:..:.
  Rat   386 FGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVS 450

  Fly   222 GWFPGKIKER--VSVSSD---PEAIFERVPKHYLPEEYGGSKGTMKDITD 266
            .:.....:.:  :...:|   |..:.:.:.|..:|:...|.  .|.|:.:
  Rat   451 PFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGE--CMCDVPE 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 15/56 (27%)
SEC14 101..256 CDD:238099 24/177 (14%)
Sec14l1NP_001101779.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 257..302 CDD:215024 15/45 (33%)
CRAL_TRIO 327..491 CDD:279044 23/175 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.