DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and CG10026

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster


Alignment Length:289 Identity:64/289 - (22%)
Similarity:126/289 - (43%) Gaps:31/289 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LPPGLQKVAIEELNEVPSRVESDIAALKEWL----QKQPHLCACLEDQFLLSFLRGSKFSLEKAK 72
            :|..::::| :|..|.||..:..|...:.::    :.|||..   :.::|..|||...:.:|.:.
  Fly    24 VPEHIRRLA-QEQGECPSSKDKVIEQFRNYILEHNECQPHRS---DAKYLEKFLRARYWKIENSY 84

  Fly    73 QKIDRFYSLQAVIPEVFNDQR--LVDNAQVLEIIRLGV--ILRIPLDEEDTGPAVTIIRAGSYDI 133
            :.:..:|.        |.:|.  ..:..:.|::..:|.  ||.:....:..|..:.|.|.|.:..
  Fly    85 KLLCSYYR--------FREQNKSFYEKVRPLDLRHVGQSDILTVTPYRDQHGHRILIYRFGLWRP 141

  Fly   134 NKFKFQDIIRVGSMFGEIMMLEDDNASVSGYLEIMDMSGVTGANLFALQPQLLSKFSAYADEAMP 198
            |:....||.|...:..|:..||..:..|.| :.|.|:..:...::..|.|.:..|..|....:||
  Fly   142 NQVTVDDIFRATIVLQELGSLEPISQIVGG-VGIFDLKDLGLEHILHLSPSVAQKMIALLVTSMP 205

  Fly   199 TRQKGIHFINVPKAFETGFKSLLGWFPGKIKERVSV-SSDPEAIFERVPKHYLPEEYGGSKGTMK 262
            .|...:|.:|....|...||....:....::|::.: .||..::.:.:...:||:.||   |..:
  Fly   206 IRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHKHINPEHLPKRYG---GLHE 267

  Fly   263 DIT-----DQMEAKLCSYRSYFEDCQHFG 286
            |.:     |.::.: ||..|..:|.:..|
  Fly   268 DYSYTLWLDMLKEQ-CSGNSIQKDMEQLG 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 9/48 (19%)
SEC14 101..256 CDD:238099 37/157 (24%)
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 9/49 (18%)
SEC14 112..265 CDD:238099 37/156 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
54.920

Return to query results.
Submit another query.