DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and CG31826

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster


Alignment Length:271 Identity:60/271 - (22%)
Similarity:97/271 - (35%) Gaps:41/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IAALKEWLQKQPHLCACLEDQFLLSFLRGSKFSLEKAKQKIDRFYSLQAVIPEVFNDQRLVDNAQ 99
            |..|::.::|...|....||..|..||..:::...||.|.|..:|..:...|.......:....|
  Fly    18 IEQLRQLVEKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRHPTWVARHPIEHYRQ 82

  Fly   100 VLEIIRLGVILRIPLDEEDTGPAVTIIRAGSYDINKFK----FQD-------IIRVGSMFGEIMM 153
            :.    .|...|..:.:.|....|.::         ||    |||       ::.:..:..|.::
  Fly    83 LF----YGTHCRYVMPQADRSGRVLVV---------FKTVDGFQDYPDYLQSLVEMDDLIFESLL 134

  Fly   154 LEDDNASVSGYLEIMDMSGVTGANLFALQPQLLSKFSAYADEAMPTRQKGIHFINVPKAFETGF- 217
            |. .....:|...|.|:.|.....|....|..: |.....:..:|..|:.:|.|      :.|| 
  Fly   135 LL-PRVQQNGITVICDLQGTNRNFLRQFSPAFM-KVVNEKNGVLPFSQRIVHII------QRGFL 191

  Fly   218 ----KSLLGWFPGK-IKERVSVSSDP--EAIFERVPKHYLPEEYGGSKGTMKDITDQMEAKLCSY 275
                .:|...|..| .||::......  ..:.|.|....||.||||....:.| |:.:...|...
  Fly   192 MHVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGGPATNVLD-TNLIFNHLSQN 255

  Fly   276 RSYFEDCQHFG 286
            ..|.|..|.:|
  Fly   256 AEYLEKLQTYG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 13/41 (32%)
SEC14 101..256 CDD:238099 35/173 (20%)
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 13/42 (31%)
CRAL_TRIO 92..237 CDD:279044 33/161 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.