DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and Rlbp1

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001099744.1 Gene:Rlbp1 / 293049 RGDID:1309649 Length:317 Species:Rattus norvegicus


Alignment Length:270 Identity:66/270 - (24%)
Similarity:123/270 - (45%) Gaps:26/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQKVAIEELNEVPSRVESDIAALKEWLQKQ----PHLCACLEDQ-------FLLSFLRGSKFSLE 69
            ||| |.:||||.....:..:..|:|.:|.|    ..|...:.::       |||.|:|..||.:.
  Rat    45 LQK-AKDELNEREETRDEAVRELQELVQAQAASGEELAVAVAERVQARDSAFLLRFIRARKFDVG 108

  Fly    70 KAKQKIDRFYSLQAVIPEVFNDQRLVDNAQVLEIIRLGVILRIP--LDEEDT-GPAVTIIRAGSY 131
            :|.:.:..:.:.:...||:|       ::..:|.:|..:....|  |...|. |..|.:....::
  Rat   109 RAYELLKGYVNFRLQYPELF-------DSLSMEALRCTIEAGYPGVLSSRDKYGRVVMLFNIENW 166

  Fly   132 DINKFKFQDIIRVGSMFGEIMMLEDDNASVSGYLEIMDMSGVTGANLFALQPQLLSKFSAYADEA 196
            ...:..|.:|::......| .:||::...::|:..:.:..|.|......|:|..|.|......::
  Rat   167 HCEEVTFDEILQAYCFILE-KLLENEETQINGFCIVENFKGFTMQQAAGLRPSDLKKMVDMLQDS 230

  Fly   197 MPTRQKGIHFINVPKAFETGFKSLLGWFPGKIKERVSVSSDP-EAIFERVPKHYLPEEYGGS--K 258
            .|.|.|.||||:.|..|.|.:..:..:...|:.:||.|..|. :..|:.:.::.||.::||:  |
  Rat   231 FPARFKAIHFIHQPWYFTTTYNVVKPFLKNKLLQRVFVHGDDLDGFFQEIDENILPADFGGTLPK 295

  Fly   259 GTMKDITDQM 268
            ...|.:.:|:
  Rat   296 YDGKVVAEQL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 13/55 (24%)
SEC14 101..256 CDD:238099 37/158 (23%)
Rlbp1NP_001099744.1 CRAL_TRIO_N 60..117 CDD:215024 13/56 (23%)
CRAL_TRIO 143..292 CDD:279044 36/149 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339633
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.