DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and SEC14L4

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_016884276.1 Gene:SEC14L4 / 284904 HGNCID:20627 Length:465 Species:Homo sapiens


Alignment Length:322 Identity:74/322 - (22%)
Similarity:126/322 - (39%) Gaps:49/322 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ELNEVPSRVESDIAALKEWLQKQPHLCACLEDQFLLSFLRGSKFSLEKAKQKIDRFYSLQAVIPE 87
            |:...|..:.|..|..:|.||....:....:|.|||.:||...|.|:|::..:.|...       
Human    63 EVMRAPPTIRSSSAQFRENLQDLLPILPNADDYFLLRWLRARNFDLQKSEDMLRRHME------- 120

  Fly    88 VFNDQRLVDNA---QVLEIIRL----GVILRIPLDEEDTGPAVTIIRAGSYD-----INKFKFQD 140
             |..|:.:||.   |..|:|:|    |:   ...|.|.......||  ||.|     ::..| ||
Human   121 -FRKQQDLDNIVTWQPPEVIQLYDSGGL---CGYDYEGCPVYFNII--GSLDPKGLLLSASK-QD 178

  Fly   141 IIRVGSMFGEIMMLEDD------NASVSGYLEIMDMSGVTGANLFALQPQLLSKFSAYADEAMPT 199
            :||......|:::.|.:      ...:...|.:.||.|::..:|:....::..:|.:..:...|.
Human   179 MIRKRIKVCELLLHECELQTQKLGRKIEMALMVFDMEGLSLKHLWKPAVEVYQQFFSILEANYPE 243

  Fly   200 RQKGIHFINVPKAFETGFKSLLGWFPGKIKERVSVSSD--PEAIFERVPKHYLPEEYGGS----K 258
            ..|.:..|..||.|...|..:..:...:.:.::.:..|  .:.:.:.:....||.|:||:    .
Human   244 TLKNLIVIRAPKLFPVAFNLVKSFMSEETRRKIVILGDNWKQELTKFISPDQLPVEFGGTMTDPD 308

  Fly   259 GTMKDITD-------QMEAKLC-SYRSYFEDCQHFGAHDKLREEASVLNPD---ESHFGVDG 309
            |..|.:|.       .....|| ..|..:|..:..|....|:.|..:|.|.   ...|..||
Human   309 GNPKCLTKINYGGEVPKSYYLCEQVRLQYEHTRSVGRGSSLQVENEILFPGCVLRWQFASDG 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 14/44 (32%)
SEC14 101..256 CDD:238099 35/171 (20%)
SEC14L4XP_016884276.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.