DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and Rlbp1

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001166954.1 Gene:Rlbp1 / 19771 MGIID:97930 Length:317 Species:Mus musculus


Alignment Length:270 Identity:67/270 - (24%)
Similarity:123/270 - (45%) Gaps:26/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQKVAIEELNEVPSRVESDIAALKEWLQKQ----PHLCACLEDQ-------FLLSFLRGSKFSLE 69
            ||| |.:||||.....|..:..|:|.:|.|    ..|...:.::       |||.|:|..||.:.
Mouse    45 LQK-AKDELNEKEETREEAVRELQELVQAQAASGEELALAVAERVQARDSAFLLRFIRARKFDVG 108

  Fly    70 KAKQKIDRFYSLQAVIPEVFNDQRLVDNAQVLEIIRLGVILRIP--LDEEDT-GPAVTIIRAGSY 131
            :|.:.:..:.:.:...||:|       ::..:|.:|..:....|  |...|. |..|.:....::
Mouse   109 RAYELLKGYVNFRLQYPELF-------DSLSMEALRCTIEAGYPGVLSSRDKYGRVVMLFNIENW 166

  Fly   132 DINKFKFQDIIRVGSMFGEIMMLEDDNASVSGYLEIMDMSGVTGANLFALQPQLLSKFSAYADEA 196
            ...:..|.:|::......| .:||::...::|:..:.:..|.|......|:|..|.|......::
Mouse   167 HCEEVTFDEILQAYCFILE-KLLENEETQINGFCIVENFKGFTMQQAAGLRPSDLKKMVDMLQDS 230

  Fly   197 MPTRQKGIHFINVPKAFETGFKSLLGWFPGKIKERVSVSSDP-EAIFERVPKHYLPEEYGGS--K 258
            .|.|.|.||||:.|..|.|.:..:..:...|:.:||.|..|. :..|:.:.::.||.::||:  |
Mouse   231 FPARFKAIHFIHQPWYFTTTYNVVKPFLKNKLLQRVFVHGDDLDGFFQEIDENILPADFGGTLPK 295

  Fly   259 GTMKDITDQM 268
            ...|.:.:|:
Mouse   296 YDGKVVAEQL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 14/55 (25%)
SEC14 101..256 CDD:238099 37/158 (23%)
Rlbp1NP_001166954.1 CRAL_TRIO_N 60..117 CDD:215024 14/56 (25%)
CRAL_TRIO 143..292 CDD:395525 36/149 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835995
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.