DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and cgr-1

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_508618.2 Gene:cgr-1 / 180650 WormBaseID:WBGene00020847 Length:383 Species:Caenorhabditis elegans


Alignment Length:253 Identity:51/253 - (20%)
Similarity:93/253 - (36%) Gaps:36/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LNEVPSRVESDIAAL----KEWLQKQPHLCACLEDQFLLSFLRGSKFSLEKAKQKIDRFYSLQAV 84
            |||:.:..:..||.|    |:.|...|....   |..||.:|.|..:.::....|:.  |:::.:
 Worm    10 LNELTAHQKDKIAELRSKTKDILATYPEYDT---DFSLLRWLMGWDYKIDVIVPKMR--YAVETL 69

  Fly    85 IPEVFNDQRLVDNAQVLEIIR--LGVILRIP---LDEEDTGPAV-----------TIIRAGSYDI 133
            :....|:::.....|:...|:  ..|....|   :.:...|..|           |:::||.   
 Worm    70 VNLGMNNKQTTSVDQINRDIKNMSAVAEYFPGGIMGKSKRGDVVYMQAMAKAHPKTLVKAGP--- 131

  Fly   134 NKFKFQDIIRVGSM-FGEIMMLEDDNASVSGYLEIMDMSGVTGANLFALQPQLLSKFSAYADEAM 197
            ....||..|....| |..|...|.:.....|.:.|||:.|.:...|:....::............
 Worm   132 TSQLFQLCISETEMSFKIIRQTEQETERKMGVIIIMDLDGFSMDLLYTPTLKVYMSLLTMLQNIF 196

  Fly   198 PTRQKGIHFINVPKAFETGFKSLLGWFPGKIKERVSVSSDPEAIFERVPKHYLPEEYG 255
            |...:.|:.||.|......:..:......:.:|:|       ...::..|::|.||.|
 Worm   197 PDFARRIYIINCPAMMSAVYAMVSPVLSSQTREKV-------RFLDKDWKNHLIEEIG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 12/48 (25%)
SEC14 101..256 CDD:238099 33/172 (19%)
cgr-1NP_508618.2 SEC14 91..257 CDD:214706 32/167 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.