DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and H41C03.1

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_495168.1 Gene:H41C03.1 / 173994 WormBaseID:WBGene00019268 Length:396 Species:Caenorhabditis elegans


Alignment Length:272 Identity:55/272 - (20%)
Similarity:98/272 - (36%) Gaps:70/272 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KEWLQKQPHLCACLEDQF------LLSFLRGSKFSLEKAKQKIDR------FYSLQAVIPEVFND 91
            :|::....|.|..|..::      ||.:.:|..|..::|..::.|      :|.|..::..|   
 Worm     6 REFVDYLRHECKDLLTEYYDTDFNLLRWAQGYGFDKDEALAELRRHLRFRQYYDLDNILTNV--- 67

  Fly    92 QRLVDNAQVLEIIRLGVILRIPLDEEDTGPAVTIIRAGSYD--------------INKFKFQDII 142
               .|:..:.:...||::.....|.:    .:.|..||..|              |.:||||:  
 Worm    68 ---PDHPILKKYFPLGLVGETGKDNQ----LLVIECAGRIDLMGILKSVHLSDFLIQRFKFQE-- 123

  Fly   143 RVGSMFGEIMMLEDDNASVSGYLEIMDMSG----------VTGANLFALQPQLLSKFSAYADEAM 197
               .|...:..:|....:....:.|:|:.|          |||       |..:...|.|.  |.
 Worm   124 ---KMLAAMNEMERKYGTQCSVIYILDLEGLKFDPALISIVTG-------PYRILWASVYT--AY 176

  Fly   198 PTRQKGIHFINVPKAFETGFKSLLGWFPGKIKERVSVSSDPEAIFERVPKH----YLPEEYGGS- 257
            |.....:..||.|......:|::....|.:.:.:|.:.|........|.||    .:|:.:||: 
 Worm   177 PEWINTLFLINAPSFMTLLWKAIGPLLPERTRNKVRICSGNSDWKTSVQKHAHIDNIPKHWGGTL 241

  Fly   258 -----KGTMKDI 264
                 .|..:||
 Worm   242 VDKNGDGMCRDI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 9/43 (21%)
SEC14 101..256 CDD:238099 36/182 (20%)
H41C03.1NP_495168.1 SEC14 69..242 CDD:214706 39/190 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.