DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and Sec14l2

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_446253.2 Gene:Sec14l2 / 116486 RGDID:621779 Length:403 Species:Rattus norvegicus


Alignment Length:309 Identity:71/309 - (22%)
Similarity:124/309 - (40%) Gaps:51/309 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LNEVPSRVESDIAALKEWLQKQPHLCACLEDQFLLSFLRGSKFSLEKA-----------KQK-ID 76
            :.::..:.|..:|..:|.:|.........:|.|||.:||...|.|:|:           ||| ||
  Rat     5 VGDLSPKQEEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDID 69

  Fly    77 RFYSLQAVIPEVFNDQRLVDNAQVLEIIRLGVIL-RIPLDEEDTGPAVT---IIRAGSYDINKFK 137
            :..|.|.  |||..        |.|...|.|..| ..|:..:..||...   :..|...|:.:.|
  Rat    70 KIISWQP--PEVIQ--------QYLSGGRCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTK 124

  Fly   138 FQDIIRVGSMFGEIMMLE--DDNASVSGYLE----IMDMSGVTGANLFALQPQLLSKFSAYADEA 196
            .:|.        |:::.|  ...|.:...:|    |.|..|:...:|:....:...:|....:|.
  Rat   125 MRDC--------ELLLQECTHQTAKLGKKIETITMIYDCEGLGLKHLWKPAVEAYGEFLTMFEEN 181

  Fly   197 MPTRQKGIHFINVPKAFETGFKSLLGWFPGKIKERVSV--SSDPEAIFERVPKHYLPEEYGGSKG 259
            .|...|.:..:..||.|...:..:..:.....::::.|  ::..|.:.:.:....||.|||   |
  Rat   182 YPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQLPVEYG---G 243

  Fly   260 TMKDITDQMEAKLCSYRSYFEDC-QHFGAHDKLRE--EASV-LNPDESH 304
            ||.|.....:.|  |..:|..|. :.:...|::::  |.|| ::...||
  Rat   244 TMTDPDGNPKCK--SKINYGGDIPKQYYVRDQVKQQYEHSVQISRGSSH 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 17/56 (30%)
SEC14 101..256 CDD:238099 32/166 (19%)
Sec14l2NP_446253.2 CRAL_TRIO_N 13..59 CDD:215024 13/45 (29%)
SEC14 76..244 CDD:214706 37/188 (20%)
GOLD_2 300..381 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.