DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and Sec14l4

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_666125.1 Gene:Sec14l4 / 103655 MGIID:2144095 Length:403 Species:Mus musculus


Alignment Length:271 Identity:55/271 - (20%)
Similarity:106/271 - (39%) Gaps:57/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ELNEVPSRVESDIAALKEWLQKQPHLCACLEDQFLLSFLRGSKFSLEKAKQKIDRFYSLQAVIPE 87
            ::.::..:.:..:|..:|.||.........:|.|||.:||...|.|:|::..:.:...       
Mouse     4 QVGDLSPQQQEALARFRETLQDLLPTLPKADDYFLLRWLRARNFDLKKSEDMLRKHVE------- 61

  Fly    88 VFNDQRLVDNA---QVLEIIRLGVILRIPLDEEDTGPAVTIIRAGSYDIN--------------K 135
             |.:|:.:|..   |..|:|:|          .|:|      ....||..              |
Mouse    62 -FRNQQNLDQILTWQAPEVIQL----------YDSG------GLSGYDYEGCPVWFDIIGTMDPK 109

  Fly   136 FKF-----QDIIRVGSMFGEIMMLEDDNAS------VSGYLEIMDMSGVTGANLFALQPQLLSKF 189
            ..|     ||:||......|:::.|.:..|      :...:.:.||.|::..:|:....::..:|
Mouse   110 GLFMSASKQDMIRKRIKVCEMLLHECELQSQKLGRKIERMVMVFDMEGLSLRHLWKPAVEVYQQF 174

  Fly   190 SAYADEAMPTRQKGIHFINVPKAFETGFKSLLGWFPGKIKERVSV--SSDPEAIFERVPKHYLPE 252
            .|..:...|...|.:..|..||.|...|..:..:...:.::::.:  .:..:.:.:.|....||.
Mouse   175 FAILEANYPETVKNLIIIRAPKLFPVAFNLVKSFMGEETQKKIVILGGNWKQELVKFVSPDQLPV 239

  Fly   253 EYGGSKGTMKD 263
            |:|   |||.|
Mouse   240 EFG---GTMTD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 13/44 (30%)
SEC14 101..256 CDD:238099 33/181 (18%)
Sec14l4NP_666125.1 CRAL_TRIO_N 13..59 CDD:215024 13/45 (29%)
SEC14 77..244 CDD:214706 34/185 (18%)
GOLD_2 284..379 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.