DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and YHP1

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_010739.3 Gene:YHP1 / 852062 SGDID:S000002859 Length:353 Species:Saccharomyces cerevisiae


Alignment Length:119 Identity:35/119 - (29%)
Similarity:58/119 - (48%) Gaps:14/119 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 SYITNSTNLQEKQLRK----RFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTE 174
            ::||:|.....|:..|    |...||.|:. |:.:|..|:..|:.....:.:||:|||:..:::|
Yeast   151 AFITHSQETFPKKEPKIDNARLARRKRRRT-SSYELGILQTAFDECPTPNKAKRIELSEQCNMSE 214

  Fly   175 VQVKTWFQNRRTKWKKQL----TSRLKIAHRHGLWI-----PTLPITTIIPNTK 219
            ..|:.||||:|...||..    ||..|:.....:.:     ..|.||:...:||
Yeast   215 KSVQIWFQNKRQAAKKHKNSGNTSHCKVHSNDSMSMISYSDAALEITSTPTSTK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 17/52 (33%)
YHP1NP_010739.3 COG5576 123..278 CDD:227863 35/119 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.