DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and HAT3

DIOPT Version :10

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_191598.1 Gene:HAT3 / 825210 AraportID:AT3G60390 Length:315 Species:Arabidopsis thaliana


Alignment Length:76 Identity:24/76 - (31%)
Similarity:35/76 - (46%) Gaps:11/76 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 NSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQ 182
            |..:...|:||           .|..|...||..|.....|:..:::.|:|.|:|...||:.|||
plant   155 NGDDSSRKKLR-----------LSKEQALVLEETFKEHSTLNPKQKMALAKQLNLRTRQVEVWFQ 208

  Fly   183 NRRTKWKKQLT 193
            |||.:.|.:.|
plant   209 NRRARTKLKQT 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeodomain 134..190 CDD:459649 18/55 (33%)
HAT3NP_191598.1 HD-ZIP_N 19..118 CDD:461370
Homeodomain 161..215 CDD:459649 21/64 (33%)
HALZ 217..260 CDD:128634 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.