Sequence 1: | NP_001246894.1 | Gene: | CG34031 / 3885665 | FlyBaseID: | FBgn0054031 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_703149.1 | Gene: | ESX1 / 80712 | HGNCID: | 14865 | Length: | 406 | Species: | Homo sapiens |
Alignment Length: | 245 | Identity: | 54/245 - (22%) |
---|---|---|---|
Similarity: | 91/245 - (37%) | Gaps: | 83/245 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 EKSIQTKKKGKLGAFSIDSILSTSEAHSSQNSLPKDNTNVTSSDISKLYAFSFTQEG-------- 73
Fly 74 -NNKTPLTNFDLCQGHPRRLPI----------TFDGSTVSRFVWRTESILPSYITNSTNLQEKQL 127
Fly 128 RKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKK-- 190
Fly 191 -----QLTSRLKIAHRHGLW-------------------IPTLPITTIIP 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34031 | NP_001246894.1 | Homeobox | 136..189 | CDD:278475 | 24/52 (46%) |
ESX1 | NP_703149.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..21 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 33..142 | 21/137 (15%) | |||
Nuclear localization signal. /evidence=ECO:0000255 | 138..143 | 2/6 (33%) | |||
Homeobox | 142..195 | CDD:278475 | 24/52 (46%) | ||
15 X 9 AA tandem repeats of P-P-x-x-P-x-P-P-x | 244..378 | 1/5 (20%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 341..364 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |