DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Hoxa6

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001178016.1 Gene:Hoxa6 / 685732 RGDID:1590236 Length:233 Species:Rattus norvegicus


Alignment Length:103 Identity:37/103 - (35%)
Similarity:54/103 - (52%) Gaps:26/103 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 YITNSTNLQEKQLRKRFTDRK--------------------------PRQAYSASQLERLENEFN 153
            |..:|:::|.|.|.:..||||                          .||.|:..|...||.||:
  Rat   111 YKPDSSSVQGKALHEEGTDRKYTSPVYPWMQRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFH 175

  Fly   154 LDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQ 191
            .::||:..:|:|::.:|.|||.|:|.||||||.||||:
  Rat   176 FNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 25/52 (48%)
Hoxa6NP_001178016.1 Homeobox 159..212 CDD:395001 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.