DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Barhl2

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_075245.1 Gene:Barhl2 / 65050 RGDID:620726 Length:384 Species:Rattus norvegicus


Alignment Length:191 Identity:59/191 - (30%)
Similarity:85/191 - (44%) Gaps:46/191 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AFSIDSILSTSE----------AHSSQNSLPKDNTNVTSSDI-SKLYAFSFTQEGNNKTPL---- 79
            :|.|..||..|:          :.||.:..||...|...... .||      ::.::||.|    
  Rat   138 SFLIKDILGDSKPLAACAPYSTSVSSPHHTPKQECNAAHESFRPKL------EQEDSKTKLDKRE 196

  Fly    80 -TNFDL-CQGHPRRLPITFDGSTVSRFVWRTESILPSYITNSTNLQEKQLRKRFTDRKPRQAYSA 142
             :..|: |.|                    |:......||:|......:.:|   .||.|.|:|.
  Rat   197 DSQSDIKCHG--------------------TKEEGDREITSSRESPPVRAKK---PRKARTAFSD 238

  Fly   143 SQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSRLKIAHRHG 203
            .||.:||..|...|||||..|::|:.:|:||:.|||||:||||||||:|....|::....|
  Rat   239 HQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRTKWKRQTAVGLELLAEAG 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 29/52 (56%)
Barhl2NP_075245.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..134
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..237 22/111 (20%)
Homeobox 233..285 CDD:278475 29/51 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..384
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.