DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and vox

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_571773.1 Gene:vox / 64807 ZFINID:ZDB-GENE-010108-1 Length:242 Species:Danio rerio


Alignment Length:186 Identity:45/186 - (24%)
Similarity:76/186 - (40%) Gaps:53/186 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 QEGNNKT-----------PLTNFDLCQGHPRRLPITFDGSTVSRFVWRTES-------------I 111
            ||...||           |.|::|.....|:        ..:::...:|||             .
Zfish    23 QEPEKKTRPHVPCVVQPRPPTSYDKVYLQPK--------PKINKAELKTESSKETPAQVTPRNCS 79

  Fly   112 LPSYITNS---------------TNLQE-KQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSV 160
            .||:..||               .:::: ....|....|:.|..::..|:::||..||..|||..
Zfish    80 SPSFSENSGYSSGYESEAAASECASVEDGHDAEKDGATRRIRTKFTPEQIDKLEKIFNKHKYLDA 144

  Fly   161 SKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSRLKIAHRHGLWIPTLPITTIIP 216
            .:||:.:..|.|:|.|::|||||||.|.|:::...     |....:|.:.:..:||
Zfish   145 GERVKTALKLGLSETQIRTWFQNRRMKLKREVQEM-----RADFLLPQMVLPPVIP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 23/52 (44%)
voxNP_571773.1 COG5576 75..>187 CDD:227863 31/116 (27%)
Homeobox 121..173 CDD:278475 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.