DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and lbx2

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001007135.1 Gene:lbx2 / 64276 ZFINID:ZDB-GENE-001206-2 Length:257 Species:Danio rerio


Alignment Length:199 Identity:58/199 - (29%)
Similarity:82/199 - (41%) Gaps:39/199 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RLNSCIEKSIQTKKKGKLG-------------AFSIDSILSTSEAHSSQNSL--PKDNTNVTSSD 60
            :..|.::.|.:.:::|.|.             .|||:.||:......|..||  |:....||.|.
Zfish     9 KAGSVLQSSGEERRRGPLDQLPPPANSNKPLTPFSIEDILNKPSVKKSVGSLCPPRVLEKVTGSS 73

  Fly    61 ISKLYAFSFTQEGNNKTPLTNFDLCQGHPRRLPITFDGSTVSRFVWRTESILPSYITNSTNL--Q 123
            .|:           |.....:..|| ........||.|..|| .:...|.      ....|.  |
Zfish    74 ASR-----------NGISAPSSPLC-ALEELASKTFKGLEVS-VIQAAEG------REHINAFGQ 119

  Fly   124 EKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKW 188
            .:..:||   ||.|.|::..|:..||..|...||||.:.|.::::.|.||..||.|||||||.|.
Zfish   120 RQASKKR---RKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKL 181

  Fly   189 KKQL 192
            |:.|
Zfish   182 KRDL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 24/52 (46%)
lbx2NP_001007135.1 Required for convergent extension movement and hypaxial myogenesis during gastrulation. Required for the formation of thick and thin myofilaments. Required for myod1 expression in the pectoral fin bud. Required for continuous expression of cxcl12a in the posterior lateral mesoderm at the tail bud stage and in adaxial cells at the 10-somite stage. /evidence=ECO:0000269|PubMed:19216761, ECO:0000269|PubMed:22216300, ECO:0000269|PubMed:22406073 1..46 7/36 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 4/33 (12%)
Homeobox 129..183 CDD:395001 24/53 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..257
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.