powered by:
Protein Alignment CG34031 and CG34367
DIOPT Version :9
Sequence 1: | NP_001246894.1 |
Gene: | CG34031 / 3885665 |
FlyBaseID: | FBgn0054031 |
Length: | 219 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097140.1 |
Gene: | CG34367 / 5740879 |
FlyBaseID: | FBgn0085396 |
Length: | 420 |
Species: | Drosophila melanogaster |
Alignment Length: | 74 |
Identity: | 27/74 - (36%) |
Similarity: | 37/74 - (50%) |
Gaps: | 9/74 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 117 TNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWF 181
|:..|.::::.|..|| ..||..||..|....|.....|.|||:.|.|:|.:|:.||
Fly 185 TSLVNTKQRRSRTNFT---------LDQLNELERLFEETHYPDAFMREELSQRLGLSEARVQVWF 240
Fly 182 QNRRTKWKK 190
||||.|.:|
Fly 241 QNRRAKCRK 249
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG34031 | NP_001246894.1 |
Homeobox |
136..189 |
CDD:278475 |
21/52 (40%) |
CG34367 | NP_001097140.1 |
Homeobox |
195..248 |
CDD:278475 |
24/61 (39%) |
OAR |
392..409 |
CDD:281777 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
45 |
1.000 |
Domainoid score |
I3555 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.