DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and CG34367

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster


Alignment Length:74 Identity:27/74 - (36%)
Similarity:37/74 - (50%) Gaps:9/74 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 TNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWF 181
            |:..|.::::.|..||         ..||..||..|....|.....|.|||:.|.|:|.:|:.||
  Fly   185 TSLVNTKQRRSRTNFT---------LDQLNELERLFEETHYPDAFMREELSQRLGLSEARVQVWF 240

  Fly   182 QNRRTKWKK 190
            ||||.|.:|
  Fly   241 QNRRAKCRK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 21/52 (40%)
CG34367NP_001097140.1 Homeobox 195..248 CDD:278475 24/61 (39%)
OAR 392..409 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.