DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and AgaP_AGAP004649

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_001688960.2 Gene:AgaP_AGAP004649 / 5667524 VectorBaseID:AGAP004649 Length:548 Species:Anopheles gambiae


Alignment Length:203 Identity:53/203 - (26%)
Similarity:84/203 - (41%) Gaps:74/203 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HLEQDKSRLNSCIEKSIQTKKKGKLGAFSIDSILSTSEAHSSQNSLPKDNTNVTSSDISKLYAFS 68
            |.:|.:::.|:...|.:|.|:                              ||....::|....|
Mosquito   349 HAQQPQNQQNAPTYKWMQVKR------------------------------NVPKPPLTKSLQLS 383

  Fly    69 FTQEGNNKTPLTNFDLCQGHPRRLPITFDGSTVSRFVWRTESILPSYIT----------NSTNLQ 123
            .|.|.:..|.:.:       |.|:|   :.:||         :.||.::          |||.  
Mosquito   384 TTPEYHIPTHVLD-------PLRVP---NHTTV---------VAPSAVSPHQSSFMINNNSTG-- 427

  Fly   124 EKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKW 188
                |..||::         ||..||.||:.:|||:.::|:|::.:|.|.|.|||.||||||.|.
Mosquito   428 ----RTNFTNK---------QLTELEKEFHFNKYLTRARRIEIANALHLNETQVKIWFQNRRMKQ 479

  Fly   189 KKQLTSRL 196
            ||::...|
Mosquito   480 KKRVKEGL 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 24/52 (46%)
AgaP_AGAP004649XP_001688960.2 Homeobox 428..480 CDD:278475 27/60 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.