DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and hmx2

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001108570.3 Gene:hmx2 / 555632 ZFINID:ZDB-GENE-080506-2 Length:269 Species:Danio rerio


Alignment Length:219 Identity:73/219 - (33%)
Similarity:103/219 - (47%) Gaps:43/219 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LGAFSIDSILSTSE------AHSSQNSLPKDNTNVTSS--------DISKLYAFSFTQEG----- 73
            :.:|:|.|||.||.      ...|..|.|:..|...||        |....|.   ::.|     
Zfish    16 ISSFTIQSILGTSNDGVRSAGKDSPKSQPRKRTLSVSSEDDCSAGEDSGDCYC---SEPGVPESC 77

  Fly    74 NNKTPLTNFDLCQGHPRRLPITFDGSTVSRFVWRTESILPSY-------ITNSTNLQEKQLR--- 128
            |...|| ||  |.|..:.|....||  :.|....|.||||.|       .:..:.:.|.:.|   
Zfish    78 NPHQPL-NF--CLGATKGLLPVQDG--IDRRPHLTPSILPDYKEEQGRACSQMSPVSEDRQRDGP 137

  Fly   129 ---KRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKK 190
               .....:|.|..:|.||:.:||:.|::.:|||.|:|..|:.||.|||.||||||||||.|||:
Zfish   138 DKQNNSAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKR 202

  Fly   191 QLTSRLK---IAHRHGLWIPTLPI 211
            ||::.|:   :||.....:..:|:
Zfish   203 QLSAELEAANMAHASAQTLVGMPL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 29/52 (56%)
hmx2NP_001108570.3 Homeobox 148..201 CDD:306543 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I5169
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.