DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and hoxd1

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001016678.1 Gene:hoxd1 / 549432 XenbaseID:XB-GENE-482731 Length:301 Species:Xenopus tropicalis


Alignment Length:101 Identity:36/101 - (35%)
Similarity:51/101 - (50%) Gaps:21/101 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 TFDGSTVSRFVWRTESILPSYITNSTNLQEKQLRKRFTDRKP----RQAYSASQLERLENEFNLD 155
            |||...|.|                 |..:|.|:..:....|    |..::..||..||.||:.:
 Frog   178 TFDWMKVKR-----------------NPPKKSLQSEYGVASPPCTVRTNFTTKQLTELEKEFHFN 225

  Fly   156 KYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQ 191
            |||:.::|:|::.||.|.:.|||.||||||.|.||:
 Frog   226 KYLTRARRIEIANSLQLNDTQVKIWFQNRRMKQKKR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 26/56 (46%)
hoxd1NP_001016678.1 Antp-type hexapeptide. /evidence=ECO:0000255 178..183 3/4 (75%)
Homeobox 207..260 CDD:365835 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..301 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.