Sequence 1: | NP_001246894.1 | Gene: | CG34031 / 3885665 | FlyBaseID: | FBgn0054031 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001116229.1 | Gene: | POU1F1 / 5449 | HGNCID: | 9210 | Length: | 317 | Species: | Homo sapiens |
Alignment Length: | 195 | Identity: | 38/195 - (19%) |
---|---|---|---|
Similarity: | 71/195 - (36%) | Gaps: | 46/195 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 HSSQNSLPKDNTNVTSSDISKLYAFSFTQEGNNKTPLTNFDLCQGHP--------------RRLP 93
Fly 94 I-----------------TFDGSTVSRF---------VWRTESILPSYITNSTN---LQEKQLRK 129
Fly 130 RFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTS 194
Fly 195 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34031 | NP_001246894.1 | Homeobox | 136..189 | CDD:278475 | 14/52 (27%) |
POU1F1 | NP_001116229.1 | POU | 150..224 | CDD:197673 | 9/73 (12%) |
Homeobox | 243..297 | CDD:395001 | 14/53 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |