Sequence 1: | NP_001246894.1 | Gene: | CG34031 / 3885665 | FlyBaseID: | FBgn0054031 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001157658.1 | Gene: | Barhl1 / 54422 | MGIID: | 1859288 | Length: | 327 | Species: | Mus musculus |
Alignment Length: | 203 | Identity: | 67/203 - (33%) |
---|---|---|---|
Similarity: | 94/203 - (46%) | Gaps: | 26/203 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 CIEKSIQTKKKGKLGAFSIDSILSTSEAHSSQNSLPKDNTNVTSS--------DISKLYAFS-FT 70
Fly 71 QEGNNKTPLTNFDLC--QGHPRRLPI---TFDGSTVSRFVWRTESILPSYITNSTNLQEKQLRKR 130
Fly 131 FTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSR 195
Fly 196 LKIAHRHG 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34031 | NP_001246894.1 | Homeobox | 136..189 | CDD:278475 | 30/52 (58%) |
Barhl1 | NP_001157658.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..90 | 11/38 (29%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 113..181 | 13/72 (18%) | |||
Homeobox | 182..235 | CDD:395001 | 31/52 (60%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 303..327 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0488 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |