DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Tlx1

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001102636.1 Gene:Tlx1 / 499361 RGDID:1563655 Length:333 Species:Rattus norvegicus


Alignment Length:104 Identity:38/104 - (36%)
Similarity:58/104 - (55%) Gaps:19/104 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ITNSTNL-------QEKQLRKRFT-----------DRKPRQAYSASQLERLENEFNLDKYLSVSK 162
            :.|.|.|       ..:..:.|||           .:|||.:::..|:..||..|:..|||:.::
  Rat   169 VNNLTGLTFPWMESNRRYTKDRFTGHPYQNRTPPKKKKPRTSFTRLQICELEKRFHRQKYLASAE 233

  Fly   163 RVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSRLKIAHR 201
            |..|:|:|.:|:.|||||||||||||::| |:..:.|.|
  Rat   234 RAALAKALKMTDAQVKTWFQNRRTKWRRQ-TAEEREAER 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 26/52 (50%)
Tlx1NP_001102636.1 Homeobox 207..260 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.