powered by:
Protein Alignment CG34031 and hoxa5
DIOPT Version :9
Sequence 1: | NP_001246894.1 |
Gene: | CG34031 / 3885665 |
FlyBaseID: | FBgn0054031 |
Length: | 219 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001011405.1 |
Gene: | hoxa5 / 496880 |
XenbaseID: | XB-GENE-486061 |
Length: | 274 |
Species: | Xenopus tropicalis |
Alignment Length: | 64 |
Identity: | 29/64 - (45%) |
Similarity: | 45/64 - (70%) |
Gaps: | 2/64 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 134 RKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSRLK 197
::.|.||:..|...||.||:.::||:..:|:|::.:|.|:|.|:|.||||||.||||. ::||
Frog 200 KRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKD--NKLK 261
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.