DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and lum

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001011006.1 Gene:lum / 496415 XenbaseID:XB-GENE-1004934 Length:353 Species:Xenopus tropicalis


Alignment Length:184 Identity:36/184 - (19%)
Similarity:64/184 - (34%) Gaps:55/184 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IQTKKKGKLGAFSIDSILSTSEAHSSQNSLPKDNTNVTSSDISKL--YAFSFTQEGNNKTPLTNF 82
            :...|..|:....::.:.:.:..|...|:|.:|:.:.....:.:|  ...||    |..|.|   
 Frog   157 VTNNKISKITPNILEGLENLTHIHLQYNALKEDSISGAFKGLKQLEYLDLSF----NELTKL--- 214

  Fly    83 DLCQGHPRRLP-----ITFDGSTVSRFVWRTESILPSYITNSTNLQEKQL--RKRFTDRKPRQAY 140
                  |:.||     :.||.:.::       :|...:......||..:|  .|......|..|:
 Frog   215 ------PKGLPPSITTLYFDNNKIA-------NIPDEFFQGFKALQYLRLSNNKLKDGGVPGNAF 266

  Fly   141 SASQL-----------------ERLEN---------EFNLDKYLSVSKRVELSK 168
            :.|.|                 |.|||         :|||:.:..:...:|.||
 Frog   267 NISSLVELDLSFNELGSIPAVNEGLENLYLQVNKIQKFNLNSFCKIIGPLEYSK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 14/59 (24%)
lumNP_001011006.1 PRK15370 <56..>256 CDD:185268 21/118 (18%)
leucine-rich repeat 81..104 CDD:275380
leucine-rich repeat 105..130 CDD:275380
leucine-rich repeat 131..151 CDD:275380
leucine-rich repeat 152..175 CDD:275380 2/17 (12%)
leucine-rich repeat 176..200 CDD:275380 4/23 (17%)
leucine-rich repeat 201..221 CDD:275380 9/32 (28%)
leucine-rich repeat 222..245 CDD:275380 3/29 (10%)
PLN03150 <235..>307 CDD:178695 15/71 (21%)
leucine-rich repeat 246..270 CDD:275380 6/23 (26%)
leucine-rich repeat 271..294 CDD:275380 4/22 (18%)
leucine-rich repeat 295..320 CDD:275380 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.