DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG34031 and NPM1

DIOPT Version :9

Sequence 1:	NP_001246894.1	Gene:	CG34031 / 3885665	FlyBaseID:	FBgn0054031	Length:	219	Species:	Drosophila melanogaster
Sequence 2:	NP_001341935.1	Gene:	NPM1 / 4869	HGNCID:	7910	Length:	294	Species:	Homo sapiens

Alignment Length:	44	Identity:	13/44 - (29%)
Similarity:	22/44 - (50%)	Gaps:	2/44 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly     9 KSRLNSCIEKSIQTKKKGKLGAFSIDSILSTSEAHSSQ-NSLPK 51
            :|:.....:|..:|.|..| |..|::.|.:..:|...: .||||
Human   221 RSKGQESFKKQEKTPKTPK-GPSSVEDIKAKMQASIEKGGSLPK 263

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG34031	NP_001246894.1	Homeobox	136..189	CDD:278475
NPM1	NP_001341935.1	Required for interaction with SENP3	1..186
		Necessary for interaction with APEX1. /evidence=ECO:0000269\|PubMed:19188445	1..117
		Nucleoplasmin	18..117	CDD:397268
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	120..247		7/26 (27%)
		Nuclear localization signal. /evidence=ECO:0000255	152..157
		Nuclear localization signal. /evidence=ECO:0000255	191..197
		Required for nucleolar localization	243..294		7/21 (33%)
		NPM1-C	245..291	CDD:406641	6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0488
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900