DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and hbn

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster


Alignment Length:80 Identity:28/80 - (35%)
Similarity:46/80 - (57%) Gaps:2/80 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LPSYITNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQ 176
            |.|.:.|..:|.:.:..::.  |:.|..::..||.:||..|...:|..|..|.:|:..|.|:|.:
  Fly   134 LSSSLNNGHDLSDMERPRKV--RRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEAR 196

  Fly   177 VKTWFQNRRTKWKKQ 191
            |:.||||||.||:|:
  Fly   197 VQVWFQNRRAKWRKR 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 21/52 (40%)
hbnNP_788420.1 Homeobox 156..209 CDD:278475 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.