powered by:
Protein Alignment CG34031 and AgaP_AGAP008025
DIOPT Version :9
| Sequence 1: | NP_001246894.1 |
Gene: | CG34031 / 3885665 |
FlyBaseID: | FBgn0054031 |
Length: | 219 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_001237930.2 |
Gene: | AgaP_AGAP008025 / 4578357 |
VectorBaseID: | AGAP008025 |
Length: | 122 |
Species: | Anopheles gambiae |
| Alignment Length: | 61 |
Identity: | 13/61 - (21%) |
| Similarity: | 25/61 - (40%) |
Gaps: | 8/61 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 3 PHLEQDKSRLNSCIEKSIQTKKKGKLGAFSIDSILSTSEAHSSQNSLPKDNTNV---TSSD 60
|..:.:..|::.|.:.| :..:|....|.:.:....||..:.|..|::.. |.||
Mosquito 25 PADDDETDRMSCCSDDS-----ELSVGQEVPDDLRARPTLHSPPDDLSNDSSRYSKDTPSD 80
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG34031 | NP_001246894.1 |
Homeobox |
136..189 |
CDD:278475 |
|
| AgaP_AGAP008025 | XP_001237930.2 |
None |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.
