DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and AgaP_AGAP008025

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_001237930.2 Gene:AgaP_AGAP008025 / 4578357 VectorBaseID:AGAP008025 Length:122 Species:Anopheles gambiae


Alignment Length:61 Identity:13/61 - (21%)
Similarity:25/61 - (40%) Gaps:8/61 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PHLEQDKSRLNSCIEKSIQTKKKGKLGAFSIDSILSTSEAHSSQNSLPKDNTNV---TSSD 60
            |..:.:..|::.|.:.|     :..:|....|.:.:....||..:.|..|::..   |.||
Mosquito    25 PADDDETDRMSCCSDDS-----ELSVGQEVPDDLRARPTLHSPPDDLSNDSSRYSKDTPSD 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475
AgaP_AGAP008025XP_001237930.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.