Sequence 1: | NP_001246894.1 | Gene: | CG34031 / 3885665 | FlyBaseID: | FBgn0054031 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002440.2 | Gene: | MSX2 / 4488 | HGNCID: | 7392 | Length: | 267 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 63/206 - (30%) |
---|---|---|---|
Similarity: | 96/206 - (46%) | Gaps: | 49/206 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 FSIDSILSTSEAHSSQNSLPKDNTNVTSSDISKLYAFSFTQEGNNKTPLTNFDLCQGH------- 88
Fly 89 PRRLPITFDGSTVSR------FVWRTE----SILPSYITNSTNLQEKQLRKRFTDRKPRQAYSAS 143
Fly 144 QLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTS---RLKIAHRHGLW 205
Fly 206 IPTLPITTIIP 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34031 | NP_001246894.1 | Homeobox | 136..189 | CDD:278475 | 29/52 (56%) |
MSX2 | NP_002440.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..71 | 5/23 (22%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 116..147 | 11/34 (32%) | |||
Homeobox | 145..199 | CDD:365835 | 29/53 (55%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 76 | 1.000 | Inparanoid score | I5263 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |