DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and MSX2

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_002440.2 Gene:MSX2 / 4488 HGNCID:7392 Length:267 Species:Homo sapiens


Alignment Length:206 Identity:63/206 - (30%)
Similarity:96/206 - (46%) Gaps:49/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FSIDSILSTSEAHSSQNSLPKDNTNVTSSDISKLYAFSFTQEGNNKTPLTNFDLCQGH------- 88
            ||:::::|..:.....:.||.::.:.                |....||    |..||       
Human    47 FSVEALMSDKKPPKEASPLPAESASA----------------GATLRPL----LLSGHGAREAHS 91

  Fly    89 PRRLPITFDGSTVSR------FVWRTE----SILPSYITNSTNLQEKQLRKRFTDRKPRQAYSAS 143
            |..|...|:.::|..      ..|..|    |..|.:::.:|    ..|||..|:||||..::.|
Human    92 PGPLVKPFETASVKSENSEDGAAWMQEPGRYSPPPRHMSPTT----CTLRKHKTNRKPRTPFTTS 152

  Fly   144 QLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTS---RLKIAHRHGLW 205
            ||..||.:|...:|||:::|.|.|.||:|||.|||.||||||.|.|:...:   :||:|.:    
Human   153 QLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAK---- 213

  Fly   206 IPTLPITTIIP 216
             |.||.:..:|
Human   214 -PMLPSSFSLP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 29/52 (56%)
MSX2NP_002440.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 5/23 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..147 11/34 (32%)
Homeobox 145..199 CDD:365835 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.