DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG34031 and MSX1

DIOPT Version :9

Sequence 1:	NP_001246894.1	Gene:	CG34031 / 3885665	FlyBaseID:	FBgn0054031	Length:	219	Species:	Drosophila melanogaster
Sequence 2:	NP_002439.2	Gene:	MSX1 / 4487	HGNCID:	7391	Length:	303	Species:	Homo sapiens

Alignment Length:	87	Identity:	42/87 - (48%)
Similarity:	56/87 - (64%)	Gaps:	8/87 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly   127 LRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQ 191
            |||..|:||||..::.:||..||.:|...:|||:::|.|.|.||||||.|||.||||||.|.|:.
Human   166 LRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRL 230

  Fly   192 LTS---RLKIAHRHGLWIPTLP 210
            ..:   :||:|.:     |.||
Human   231 QEAELEKLKMAAK-----PMLP 247

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG34031	NP_001246894.1	Homeobox	136..189	CDD:278475	29/52 (56%)
MSX1	NP_002439.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	18..55
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	69..117
		PTZ00449	<105..>248	CDD:185628	42/87 (48%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	133..174		4/7 (57%)
		Homeobox	175..229	CDD:395001	29/53 (55%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	76	1.000	Inparanoid score	I5263
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.960