DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and zfh2

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_524623.2 Gene:zfh2 / 43795 FlyBaseID:FBgn0004607 Length:3005 Species:Drosophila melanogaster


Alignment Length:205 Identity:53/205 - (25%)
Similarity:86/205 - (41%) Gaps:42/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NPHLEQDKSRL-NSCIEKSIQTKKKGKLGAFSIDSILSTSEAHS---SQNSLPKDNTNVTSSDIS 62
            |....||:|.| .|.:..:.|:::  ::..|...|...:|:..|   |.||....|...:.:|: 
  Fly  2033 NADTAQDQSLLAGSSLASNCQSQQ--QINIFETKSESGSSDVLSRPPSPNSGAAGNVYGSMNDL- 2094

  Fly    63 KLYAFSFTQEGNNKTPLTNFDLCQGHPRRLPI---TFD---------GSTVSRFVWRTESILPSY 115
                  ..|:      |.|.....|.|:::.|   ||:         ||..::|  .:.|...|.
  Fly  2095 ------LNQQ------LENMGSNMGPPKKMQIVGKTFEKNVAPMVTSGSVSTQF--ESNSSNSSS 2145

  Fly   116 ITNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTW 180
            .::||:..::..|.||||         .|::.|:..|..:.|...|....|||.|.|:...:..|
  Fly  2146 SSSSTSGGKRANRTRFTD---------YQIKVLQEFFENNSYPKDSDLEYLSKLLLLSPRVIVVW 2201

  Fly   181 FQNRRTKWKK 190
            |||.|.|.:|
  Fly  2202 FQNARQKQRK 2211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 16/52 (31%)
zfh2NP_524623.2 C2H2 Zn finger 561..581 CDD:275368
C2H2 Zn finger 616..633 CDD:275368
C2H2 Zn finger 1515..1542 CDD:275371
C2H2 Zn finger 1543..1564 CDD:275371
HOX 1797..1853 CDD:197696
Homeobox 2158..2210 CDD:278475 21/60 (35%)
Homeobox 2764..2816 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.