Sequence 1: | NP_001246894.1 | Gene: | CG34031 / 3885665 | FlyBaseID: | FBgn0054031 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_524623.2 | Gene: | zfh2 / 43795 | FlyBaseID: | FBgn0004607 | Length: | 3005 | Species: | Drosophila melanogaster |
Alignment Length: | 205 | Identity: | 53/205 - (25%) |
---|---|---|---|
Similarity: | 86/205 - (41%) | Gaps: | 42/205 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 NPHLEQDKSRL-NSCIEKSIQTKKKGKLGAFSIDSILSTSEAHS---SQNSLPKDNTNVTSSDIS 62
Fly 63 KLYAFSFTQEGNNKTPLTNFDLCQGHPRRLPI---TFD---------GSTVSRFVWRTESILPSY 115
Fly 116 ITNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTW 180
Fly 181 FQNRRTKWKK 190 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34031 | NP_001246894.1 | Homeobox | 136..189 | CDD:278475 | 16/52 (31%) |
zfh2 | NP_524623.2 | C2H2 Zn finger | 561..581 | CDD:275368 | |
C2H2 Zn finger | 616..633 | CDD:275368 | |||
C2H2 Zn finger | 1515..1542 | CDD:275371 | |||
C2H2 Zn finger | 1543..1564 | CDD:275371 | |||
HOX | 1797..1853 | CDD:197696 | |||
Homeobox | 2158..2210 | CDD:278475 | 21/60 (35%) | ||
Homeobox | 2764..2816 | CDD:278475 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 45 | 1.000 | Domainoid score | I3555 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |