DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and C15

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster


Alignment Length:284 Identity:66/284 - (23%)
Similarity:103/284 - (36%) Gaps:110/284 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HLEQDKSRLNSC--------------------IEKSIQTKKKGKLGA----FSIDSILS----TS 40
            |::.|.....||                    :.:|:|:::.....:    |||..:||    ||
  Fly    25 HVDVDSDSRMSCGSGSDVDMDGGSCYDESETPLSESLQSEQTRSSSSENLPFSISRLLSKPFETS 89

  Fly    41 EAHSSQN-----SLPKDNTNVTSSDISKLYAFSFTQEGNNKTPLTNFD----------------- 83
            ..|.:.|     |.|..::|..:|.          ::|..|..|...|                 
  Fly    90 HHHHNNNNHLLSSSPGSSSNNNNSG----------EKGEEKELLQQEDHDLAYKLATSIANSTYG 144

  Fly    84 --------------LCQGH-----PRRLPITFDGSTVSRFVW-----------------RTESIL 112
                          ...||     |:|.|:|          |                 |..:..
  Fly   145 SAAALYSYPHLYPSAAGGHVLRVPPQRTPLT----------WALPPLHHAALAHQAVKDRLAAAF 199

  Fly   113 PSYITNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQV 177
            |.........|.:...||   :|||.:::..|:..||..|:..|||:.::|..|::.|.:|:.||
  Fly   200 PIARRIGHPYQNRTPPKR---KKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQV 261

  Fly   178 KTWFQNRRTKWKKQLTSRLKIAHR 201
            |||||||||||::| |:..:.|.|
  Fly   262 KTWFQNRRTKWRRQ-TAEEREAER 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 25/52 (48%)
C15NP_476873.2 COG5576 <196..315 CDD:227863 35/93 (38%)
Homeobox 220..273 CDD:278475 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.