DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and lbe

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster


Alignment Length:223 Identity:60/223 - (26%)
Similarity:83/223 - (37%) Gaps:67/223 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HLEQDKSRLNSCIEKSIQTKKKGK---LGAFSIDSILSTSEAHSSQNSLPKDNTNVTSSDISKLY 65
            |.||   ||.....:.:|.....:   |....::..:..||..||:.|....::|.::...|...
  Fly   223 HYEQ---RLALDYHRQLQEHFNAQAQLLRHMGMNPAIIASEDGSSERSQRSSSSNGSTECCSPRQ 284

  Fly    66 AFSF----TQEG-------------------NNKTPL--------TNFDLCQGHPRRLPITFDGS 99
            |...    ||||                   |..|||        .:||..|          |.|
  Fly   285 AEKLEKLTTQEGSEEAQKKKSEEQPTGSGKSNGDTPLDALFQMTTKDFDESQ----------DKS 339

  Fly   100 TVSRFVWRTESILPSYITNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRV 164
            .:..|              |...|.|:      .||.|.|::..|:..||..|...||||.:.|.
  Fly   340 HLDIF--------------SNRPQPKK------KRKSRTAFTNHQIFELEKRFLYQKYLSPADRD 384

  Fly   165 ELSKSLSLTEVQVKTWFQNRRTKWKKQL 192
            |::.||.|:..||.|||||||.|.|:.:
  Fly   385 EIAASLGLSNAQVITWFQNRRAKQKRDI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 25/52 (48%)
lbeNP_524435.2 Homeobox 356..410 CDD:395001 25/53 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.