DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and HHEX

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster


Alignment Length:111 Identity:34/111 - (30%)
Similarity:55/111 - (49%) Gaps:16/111 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 CQGHPRRLPITFDGSTVSRFVWRTESILPSYITNSTNLQEKQLRKRFTDRKPRQAYSASQLERLE 149
            |:|.|       :.::.:..::.......|:..::..::.|..:.|||         :.|.:.||
  Fly   162 CEGFP-------NPASAAAALYCNAYPAASFYMSNFGVKRKGGQIRFT---------SQQTKNLE 210

  Fly   150 NEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSR 195
            ..|...||||..:|..|:..|.||:.||||||||||.||::...|:
  Fly   211 ARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWRRANLSK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 24/52 (46%)
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 27/58 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.