DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and Ubx

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:167 Identity:49/167 - (29%)
Similarity:72/167 - (43%) Gaps:51/167 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 STSEAHSSQN-----------SLPKDNTNVTSSDISKLYAFSFTQEGNNKTPLTNFDLCQGHPRR 91
            :.|..|.:.|           ..|:|.|.      ||:.: ..||.|...|.:            
  Fly   227 AASSLHQASNHTFYPWMAIAGECPEDPTK------SKIRS-DLTQYGGISTDM------------ 272

  Fly    92 LPITFDGSTVSRFVWRTESILPSYI-TNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLD 155
                  |...|..:  ..|:||.:: ||.       ||     |:.||.|:..|...||.||:.:
  Fly   273 ------GKRYSESL--AGSLLPDWLGTNG-------LR-----RRGRQTYTRYQTLELEKEFHTN 317

  Fly   156 KYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQL 192
            .||:..:|:|::.:|.|||.|:|.||||||.|.||::
  Fly   318 HYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 25/52 (48%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.