DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and NK7.1

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster


Alignment Length:209 Identity:63/209 - (30%)
Similarity:86/209 - (41%) Gaps:47/209 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LNSCIEKSIQTKKKGKLGAFSIDSILSTSEAH--------------SSQNSLPKDNTNVTSSDI- 61
            ||.|:.|..:......:.|.....||..|...              ||..:||.|.:...|||. 
  Fly   283 LNLCVVKKSRDSNNSPMPATKQSQILGKSATKKESSGKPAAKKKKLSSTVALPPDISPTGSSDSL 347

  Fly    62 --SKLYAFSFTQEGNNKTPLTNFDLCQGHPRRLPITFDGSTVSRFVWRTESILPSYITNSTNLQE 124
              .||.|.:.:..|:|    .|..:.......|..|.|.|.                :.||:.:.
  Fly   348 MRDKLMANNSSSPGSN----VNAQMQSNANSTLETTEDDSD----------------SGSTDARR 392

  Fly   125 KQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWK 189
            |        :|.|..::..|:..||..|...||||.|:|.|::|.|.:||.|||.||||||||||
  Fly   393 K--------KKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWK 449

  Fly   190 KQ--LTSRLKIAHR 201
            ||  :|:.....|:
  Fly   450 KQDNVTNNEAAEHK 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 27/52 (52%)
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.