DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and nkx1.2lb

DIOPT Version :10

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_998713.1 Gene:nkx1.2lb / 407077 ZFINID:ZDB-GENE-040615-2 Length:373 Species:Danio rerio


Alignment Length:82 Identity:43/82 - (52%)
Similarity:52/82 - (63%) Gaps:7/82 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 TNSTNLQEKQLRKRF-------TDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTE 174
            :|..|.|.|..|||.       ..|:.|.|::..||..|||:|...:||||.:|:.|:.||||||
Zfish   204 SNGQNHQVKPKRKRSGSDSKSGKPRRARTAFTYEQLVALENKFKSTRYLSVCERLNLALSLSLTE 268

  Fly   175 VQVKTWFQNRRTKWKKQ 191
            .|||.||||||||||||
Zfish   269 TQVKIWFQNRRTKWKKQ 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeodomain 134..190 CDD:459649 33/55 (60%)
nkx1.2lbNP_998713.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..74
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..231 8/26 (31%)
Homeodomain 228..284 CDD:459649 33/55 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..328 5/5 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.