DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and mnx2b

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001315287.1 Gene:mnx2b / 406206 ZFINID:ZDB-GENE-040415-2 Length:328 Species:Danio rerio


Alignment Length:182 Identity:56/182 - (30%)
Similarity:82/182 - (45%) Gaps:21/182 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 HSSQNSLPKDN---------TNVTSSDISKLYAFSFTQEGNNKTPLTNF-DLCQGHPRRLPITFD 97
            |.....:||..         |::.....:.:|..|.....:.....|.| .|.|.:|.:|.....
Zfish    56 HLQPGIIPKPGLLNLPHPGLTSIPGMYTTPMYPISALGGQHPALAYTGFTQLTQPYPEQLKAAAM 120

  Fly    98 GSTVSRFVWRTESI----LPSYIT--NSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDK 156
            ..::....|....|    ||.|..  .|..:...|.......|:||.|:::.||..|||:|.|:|
Zfish   121 AGSLPLEHWIRAGIMVPRLPDYTCEWGSIQMTAPQSGLMGKCRRPRTAFTSQQLLELENQFKLNK 185

  Fly   157 YLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWK-----KQLTSRLKIAHRHG 203
            |||..||.|::.||.|||.|||.||||||.|||     |:..:::::..:.|
Zfish   186 YLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSRKAKEQAAQVEVERQRG 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 32/52 (62%)
mnx2bNP_001315287.1 Homeobox 165..218 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.