DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and cdx1a

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_998001.2 Gene:cdx1a / 405762 ZFINID:ZDB-GENE-050510-1 Length:228 Species:Danio rerio


Alignment Length:157 Identity:43/157 - (27%)
Similarity:65/157 - (41%) Gaps:40/157 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 HSSQNSLPKDNTNVTSSDISKLYAFSFTQEGNNKTPLTNFDLCQGHP--RRLPITFDGSTVSRFV 105
            |.:.:|||.:...|                  :..|..:..|..|.|  |..|..          
Zfish    75 HGTGHSLPANGVEV------------------SVLPSVDQGLLSGAPVDREEPQD---------- 111

  Fly   106 WRTESILPSYITNSTNLQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSL 170
            |...|.:|:.....|..::|.          |..||..|...||.||:..:|:::.::.||:.:|
Zfish   112 WMRRSAVPTNPGGKTRTKDKY----------RVVYSDVQRLELEKEFHFSRYITIRRKAELAGTL 166

  Fly   171 SLTEVQVKTWFQNRRTKWKKQLTSRLK 197
            :|:|.|||.||||||.|.:|....||:
Zfish   167 NLSERQVKIWFQNRRAKERKMNKKRLQ 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 24/52 (46%)
cdx1aNP_998001.2 Caudal_act 11..115 CDD:282574 12/67 (18%)
COG5576 <122..227 CDD:227863 29/82 (35%)
Homeobox 133..185 CDD:278475 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.