powered by:
Protein Alignment CG34031 and Dbx
DIOPT Version :9
Sequence 1: | NP_001246894.1 |
Gene: | CG34031 / 3885665 |
FlyBaseID: | FBgn0054031 |
Length: | 219 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_647677.2 |
Gene: | Dbx / 38254 |
FlyBaseID: | FBgn0261723 |
Length: | 741 |
Species: | Drosophila melanogaster |
Alignment Length: | 64 |
Identity: | 28/64 - (43%) |
Similarity: | 37/64 - (57%) |
Gaps: | 6/64 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 132 TDRKPRQ------AYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWK 189
|..|||: .:|.||.:.||..|...||:|...|.:|::.|.|.:.|||.||||||.||:
Fly 427 TRGKPRRGMMRRAVFSDSQRKGLEKRFQQQKYISKPDRKKLAERLGLKDSQVKIWFQNRRMKWR 490
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I4196 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0488 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.