DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34031 and gsb-n

DIOPT Version :9

Sequence 1:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster


Alignment Length:164 Identity:47/164 - (28%)
Similarity:79/164 - (48%) Gaps:28/164 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LSTSEAHSSQNSLPKDNTNVTSSDISKLYAFSFTQEGNNKTPLTN--FDLCQGHPRRLPITFDGS 99
            :::.|..:..:.|.|:|.::.|.:|.:    ...:||....|.|:  ..|.:|..|       ||
  Fly    94 VTSPEIETRIDELRKENPSIFSWEIRE----KLIKEGFADPPSTSSISRLLRGSDR-------GS 147

  Fly   100 TVSRFVWRTESIL---PSYITNSTN-----LQEKQLRKRFTDRKPRQAYSASQLERLENEFNLDK 156
            ...|..:....||   .|.|:::.:     |:.||.|.|.|       ::|.|||.||..|:..:
  Fly   148 EDGRKDYTINGILGGRDSDISDTESEPGIPLKRKQRRSRTT-------FTAEQLEALERAFSRTQ 205

  Fly   157 YLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKK 190
            |..|..|.||:::.:|||.:::.||.|||.:.:|
  Fly   206 YPDVYTREELAQTTALTEARIQVWFSNRRARLRK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 20/52 (38%)
gsb-nNP_523862.1 PAX 20..141 CDD:278709 11/50 (22%)
Homeobox 185..238 CDD:278475 22/59 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.